Proteintech, 84376-3-RR, GADD45A Recombinant monoclonal antibody

Size: 20ul / 100ul The GADD45A (84376-3-RR) by Proteintech is a Recombinant antibody targeting GADD45A in IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84376-3-RR targets GADD45A in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: K-562 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4687 Product name: Recombinant human GADD45A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 5-165 aa of BC011757 Sequence: EFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER Predict reactive species Full Name: growth arrest and DNA-damage-inducible, alpha Calculated Molecular Weight: 165 aa, 18 kDa GenBank Accession Number: BC011757 Gene Symbol: GADD45A Gene ID (NCBI): 1647 RRID: AB_3671912 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P24522 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.