Iright
BRAND / VENDOR: Proteintech

Proteintech, 84377-3-RR, COX18 Recombinant monoclonal antibody

CATALOG NUMBER: 84377-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The COX18 (84377-3-RR) by Proteintech is a Recombinant antibody targeting COX18 in WB, ELISA applications with reactivity to human, mouse samples 84377-3-RR targets COX18 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, NIH/3T3 cells, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12709 Product name: Recombinant human COX18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 187-333 aa of BC101684 Sequence: ALRNLSTGAAHSEGFSVQEQLATGGILWFPDLTAPDSTWILPISVGVINLLIVEICALQKIGMSRFQTYITYFVRAMSVLMIPIAATVPSSIVLYWLCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISRK Predict reactive species Full Name: COX18 cytochrome c oxidase assembly homolog (S. cerevisiae) Calculated Molecular Weight: 333 aa, 37 kDa Observed Molecular Weight: 37-40 kDa, 28-30 kDa GenBank Accession Number: BC101684 Gene Symbol: COX18 Gene ID (NCBI): 285521 RRID: AB_3671914 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8N8Q8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924