Proteintech, 84388-5-RR, PDGFR beta/CD140b Recombinant monoclonal antibody

Size: 20ul / 100ul The PDGFR beta/CD140b (84388-5-RR) by Proteintech is a Recombinant antibody targeting PDGFR beta/CD140b in WB, IF/ICC, ELISA applications with reactivity to mouse samples 84388-5-RR targets PDGFR beta/CD140b in WB, IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, C2C12 cells Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Platelet-derived growth Factor Receptor Beta (PDGFRβ) is a member of the receptor tyrosine kinase family of proteins, which plays a crucial role in various physiological and pathological conditions. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1533 Product name: Recombinant Mouse PDGFR beta protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 32-531 aa of NM_008809.2 Sequence: LVITPPGPEFVLNISSTFVLTCSGSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLPMDSEDLFIFVTDVTETTIPCRVTDPQLEVTLHEKKVDIPLHVPYDHQRGFTGTFEDKTYICKTTIGDREVDSDTYYVYSLQVSSINVSVNAVQTVVRQGESITIRCIVMGNDVVNFQWTYPRMKSGRLVEPVTDYLFGVPSRIGSILHIPTAELSDSGTYTCNVSVSVNDHGDEKAINISVIENGYVRLLETLGDVEIAELHRSRTLRVVFEAYPMPSVLWLKDNRTLGDSGAGELVLSTRNMSETRYVSELILVRVKVSEAGYYTMRAFHEDDEVQLSFKLQVNVPVRVLELSESHPANGEQTIRCRGRGMPQPNVTWSTCRDLKRCPRKLSPTPLGNSSKEESQLETNVTFWEEDQEYEVVSTLRLRHVDQPLSVRCMLQNSMGGDSQEVTVVPHSLPFKV Predict reactive species Full Name: platelet derived growth factor receptor, beta polypeptide Calculated Molecular Weight: 123kDa Observed Molecular Weight: 180 kDa GenBank Accession Number: NM_008809.2 Gene Symbol: PDGFR beta Gene ID (NCBI): 18596 RRID: AB_3671924 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P05622-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.