Proteintech, 84404-1-RR, LRRC2 Recombinant monoclonal antibody

Size: 20ul / 100ul The LRRC2 (84404-1-RR) by Proteintech is a Recombinant antibody targeting LRRC2 in IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84404-1-RR targets LRRC2 in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Positive FC (Intra) detected in: U-251 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Leucine Rich Repeat Containing 2 (LRRC2) was found to be localized to the mitochondria in human cells and transcriptionally regulated by the mitochondrial master regulator Pgc-1α. It has been reported that Lrrc2 transcript abundance correlates with that of β-MHC, a canonical marker of cardiac hypertrophy in humans, and experimentally demonstrated an elevation in Lrrc2 transcript in vitro and in vivo rodent models of cardiac hypertrophy as well as in patients with dilated cardiomyopathy. (PMID: 28158196) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27830 Product name: Recombinant human LRRC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-200 aa of BC029118 Sequence: ETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVAECRRKGIPQAVYCKNGFIDTSVRLLDKIERNTLTRQSSLPKDRGKRSSAFVFELSGEHWTELPDSLKEQTHLREWYISNTLIQIIPTYIQLFQAMRILDLPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGN Predict reactive species Full Name: leucine rich repeat containing 2 Calculated Molecular Weight: 371 aa, 43 kDa GenBank Accession Number: BC029118 Gene Symbol: LRRC2 Gene ID (NCBI): 79442 RRID: AB_3671933 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9BYS8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.