Proteintech, 84413-3-RR, CCL20/MIP-3 alpha Recombinant monoclonal antibody

Size: 20ul / 100ul The CCL20/MIP-3 alpha (84413-3-RR) by Proteintech is a Recombinant antibody targeting CCL20/MIP-3 alpha in WB, IHC, ELISA applications with reactivity to human, mouse samples 84413-3-RR targets CCL20/MIP-3 alpha in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: THP-1 cells, HepG2 cells, RAW 264.7 cells, HuH-7 cells, SMMC-7721 cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1250-1:5000 Background Information CCL20, also known as macrophage infiltrating factor protein 3α, is a C-C chemokine that specifically binds to the receptor CCR6. CCL20 is produced in various tissues and by a wide range of immune cells, including neutrophils, natural killer cells, T-helper type 17 (Th17) cells, B cells, and various antigen-presenting cells, such as dendritic cells (DCs), Langerhans cells, and macrophages. Increased expression of CCL20 is likely involved in the increased recruitment of dendritic cells observed in fibroinflammatory diseases such as chronic obstructive pulmonary disease (COPD). CCL20 expression is increased by the proinflammatory cytokine IL-1 beta. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2398 Product name: Recombinant Human CCL20/MIP-3 alpha protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 27-96 aa of NM_004591.3 Sequence: ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM Predict reactive species Full Name: chemokine (C-C motif) ligand 20 Calculated Molecular Weight: 11kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: NM_004591.3 Gene Symbol: CCL20/MIP-3 alpha Gene ID (NCBI): 6364 RRID: AB_3671942 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P78556-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.