Iright
BRAND / VENDOR: Proteintech

Proteintech, 84425-5-RR, PERM1 Recombinant monoclonal antibody

CATALOG NUMBER: 84425-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The PERM1 (84425-5-RR) by Proteintech is a Recombinant antibody targeting PERM1 in IHC, IF/ICC, ELISA applications with reactivity to human, rat samples 84425-5-RR targets PERM1 in IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: H9C2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information PERM1 (PGC-1/ERR-induced regulator in muscle 1) is a muscle-specific protein induced by PGC-1α and ERRα. PERM1 protein expression is mainly restricted to heart and skeletal muscle, indicating PERM1 functions as a tissue-specific regulator of mitochondrial biogenesis in response to exercise (PMID: 33549681, 36028747). Ablation of Perm1 in mice results in reduced protein expression of lipin-1 accompanied by accumulation of specific phospholipid species (PMID: 33549681). There are two major isoforms of Perm1 protein, the short isoform is about 85 kDa, and the long isoform is 105 kDa. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag23833 Product name: Recombinant human C1orf170 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-58 aa of BC006300 Sequence: MCLVFVAFATWAVRTSDPHTPDAWKTALLANVGTISAIRYFRRQAGQGRRSHSPSPSS Predict reactive species Full Name: chromosome 1 open reading frame 170 GenBank Accession Number: BC006300 Gene Symbol: C1orf170 Gene ID (NCBI): 84808 RRID: AB_3671952 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q5SV97 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924