Proteintech, 84426-5-RR, HSPA13 Recombinant monoclonal antibody

Size: 20ul / 100ul The HSPA13 (84426-5-RR) by Proteintech is a Recombinant antibody targeting HSPA13 in WB, ELISA applications with reactivity to human samples 84426-5-RR targets HSPA13 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells, fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information HSPA13 (Heat shock 70 kDa protein 13), also known as STCH (the stress 70 protein chaperone), is a member of the Hsp70 family of ATPase "stress" or "heat shock" proteins. Human STCH encodes a 60 kDa protein that is highly enriched in the ER. Recently it has been reported that overexpression of the HSPA13 gene reduces prion disease incubation time in mice. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3349 Product name: Recombinant human HSPA13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 165-471 aa of BC036370 Sequence: MPVANAVISVPAEFDLKQRNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLDVSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRKEEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNEDLFQKILVPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDPDLAVVTGVAIQAGIDGGFWPLQVSALEIPNKHLQKTNFN Predict reactive species Full Name: heat shock protein 70kDa family, member 13 Calculated Molecular Weight: 471 aa, 52 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC036370 Gene Symbol: HSPA13 Gene ID (NCBI): 6782 RRID: AB_3671953 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P48723 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.