Proteintech, 84431-5-RR, TNFSF11/RANKL Recombinant monoclonal antibody

Size: 20ul / 100ul The TNFSF11/RANKL (84431-5-RR) by Proteintech is a Recombinant antibody targeting TNFSF11/RANKL in WB, IHC, ELISA applications with reactivity to mouse samples 84431-5-RR targets TNFSF11/RANKL in WB, IHC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue, mouse liver tissue Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information TNFSF11, known as Tumor Necrosis Factor Superfamily Member 11, also known as RANKL (Receptor Activator of Nuclear Factor-κB Ligand), TRANCE, etc., is a member of the Tumor Necrosis Factor (TNF) superfamily.RANKL is a type II homotrimeric transmembrane protein located primarily at the plasma membrane. RANKL is a type II homotrimeric transmembrane protein located mainly at the plasma membrane, and in addition to the membrane-bound form (mRNAKL), it can also be cleaved by proteolytic cleavage of the cell membrane to produce the soluble form (sRANKL). The membrane-bound form of RANKL is the main form involved in triggering the RANKL/RANK signaling pathway and mediating osteoclastogenesis. Current studies have shown that TNFSF11 acts primarily in the immune and skeletal systems and has been implicated in the pathogenesis of degenerative bone diseases, carcinogenesis, and asthma. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1956 Product name: Recombinant Mouse TNFSF11/RANKL protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 72-316 aa of NM_011613.3 Sequence: RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 11 Calculated Molecular Weight: 35KD Observed Molecular Weight: 22 kDa GenBank Accession Number: NM_011613.3 Gene Symbol: Tnfsf11 Gene ID (NCBI): 21943 RRID: AB_3671958 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O35235 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.