Iright
BRAND / VENDOR: Proteintech

Proteintech, 84452-1-RR, Synaptotagmin-5 Recombinant monoclonal antibody

CATALOG NUMBER: 84452-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Synaptotagmin-5 (84452-1-RR) by Proteintech is a Recombinant antibody targeting Synaptotagmin-5 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 84452-1-RR targets Synaptotagmin-5 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, rat kidney tissue, human kidney tissue, HUVEC cells, SW 1990 cells, BxPC-3 cells Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). Synaptotagmin-5 (SYT5) belongs to the synaptotagmin family. Synaptotagmin-5 can function as an exocytosis regulator (PMID: 27793683) and is a protein potentially associated with the pathology of schizophrenia (PMID: 32860155). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12677 Product name: Recombinant human SYT5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 51-386 aa of BC046157 Sequence: YRKSCRRRTGKKSQAQAQVHLQEVKGLGQSYIDKVQPEVEELEPAPSGPGQQVADKHELGQLQYSLDYDFQSGQLLVGILQAMGLAALDLGGSSDPYVRVYLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVDLGRPVQAWRELQAAPREEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGAAAGGAGLRHWADMLANPRRPIAQWHSLRPPDRVRLLPAP Predict reactive species Full Name: synaptotagmin V Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC046157 Gene Symbol: Synaptotagmin-5 Gene ID (NCBI): 6861 RRID: AB_3671978 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O00445 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924