Iright
BRAND / VENDOR: Proteintech

Proteintech, 84482-4-RR, HARBI1 Recombinant monoclonal antibody

CATALOG NUMBER: 84482-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The HARBI1 (84482-4-RR) by Proteintech is a Recombinant antibody targeting HARBI1 in WB, ELISA applications with reactivity to human samples 84482-4-RR targets HARBI1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information HARBI1, also named as harbinger transposase derived 1, is predicted to enable metal ion binding activity and nuclease activity. HARBI1 is predicted to be involved in nucleic acid phosphodiester bond hydrolysis. [provided by Alliance of Genome Resources, Apr 2022] In plants, HARBI1 genes have developed new cellular functions to benefit the host, certain HARBI1 genes in rice and Arabidopsis thaliana ( A. thaliana) have been reported to play critical roles in regulating plant growth and development.(PMID:37950159) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34137 Product name: Recombinant human HARBI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-349 aa of BC036925 Sequence: MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRPTQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIRFPADEASIQALKDEFYGLAGMPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHNISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS Predict reactive species Full Name: harbinger transposase derived 1 Calculated Molecular Weight: 349 aa, 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC036925 Gene Symbol: HARBI1 Gene ID (NCBI): 283254 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q96MB7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924