Proteintech, 84497-4-RR, GLAST/EAAT1 Recombinant monoclonal antibody

Size: 20ul / 100ul The GLAST/EAAT1 (84497-4-RR) by Proteintech is a Recombinant antibody targeting GLAST/EAAT1 in IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 84497-4-RR targets GLAST/EAAT1 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IF/ICC detected in: Neuro-2a cells Positive FC (Intra) detected in: HEK-293 cells, U-937 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SLC1A3, also known as EAAT-1 or GLAST, is a membrane-bound protein localized in glial cells and pre-synaptic glutamatergic nerve endings. It transports the excitatory neurotransmitters L-glutamate and D-aspartate, which is essential for terminating the postsynaptic acction of glutamate. Recently, a correlation between expression/function of glial EAAT-1 and tumor proliferation has been reported. The exceptionally rare expression of EAAT-1 in non-neoplastic choroid plexus (CP) compared to choroid plexus tumors (CPT) may distinguishes neoplastic from normal CP. There are a number of splicing variants of SLC1A3, like GLAST1a and GLAST1b, exist due to the exon skipping. It also undergo glycosylation. Variety of bands can be observed in the western blotting assay: 50-55 kDa represents the unglycosylated GLAST1a or GLAST1b, 65-70 kDa correspond to the glycosylated proteins, larger proteins between 90-130 kDa may be the multimers of SLC1A3. (11086157, 17471058, 12546822) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag16962 Product name: Recombinant human SLC1A3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 471-542 aa of BC037310 Sequence: VDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM Predict reactive species Full Name: solute carrier family 1 (glial high affinity glutamate transporter), member 3 Calculated Molecular Weight: 542 aa, 60 kDa GenBank Accession Number: BC037310 Gene Symbol: GLAST Gene ID (NCBI): 6507 RRID: AB_3672010 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P43003 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.