Iright
BRAND / VENDOR: Proteintech

Proteintech, 84510-4-RR, TMEM41B Recombinant monoclonal antibody

CATALOG NUMBER: 84510-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The TMEM41B (84510-4-RR) by Proteintech is a Recombinant antibody targeting TMEM41B in WB, ELISA applications with reactivity to human samples 84510-4-RR targets TMEM41B in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, A549 cells, A2780 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Transmembrane protein 41B (TMEM41B), also known as Stasimon, is a major target of survival motor neuron (SMN)-dependent U12 splicing and has been identified as a protein required for motor circuit function (PMID: 23063131). TMEM41B localizes to the endoplasmic reticulum. It is involved in autophagosome biogenesis and lipid mobilization (PMID: 30126924). TMEM41B has been shown to be essential for mouse embryonic development (PMID: 30352685). Additionally, genome-scale CRISPR knockout screens reveal that TMEM41B is required for infection of flavivirus and coronavirus, including SARS-CoV-2 (PMID: 33052348; 33052332). Alternative splicing results in three transcript variants encoding distinct isoforms. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30810 Product name: Recombinant human TMEM41B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC035034 Sequence: MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGSARMSLLILVSIFLSAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTF Predict reactive species Full Name: transmembrane protein 41B Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: BC035034 Gene Symbol: TMEM41B Gene ID (NCBI): 440026 RRID: AB_3672019 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q5BJD5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924