Proteintech, 84511-2-RR, MCM2 Recombinant monoclonal antibody

Size: 20ul / 100ul The MCM2 (84511-2-RR) by Proteintech is a Recombinant antibody targeting MCM2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84511-2-RR targets MCM2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells, Jurkat cells, A431 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, MCF-7 cells Positive FC (Intra) detected in: HeLa cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The MCM2-7 complex forms the core of the replicative helicase which acts as the molecular motor that uses ATP binding and hydrolysis to fuel the unwinding of double-stranded DNA at the replication fork in eukaryotes. This complex is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. MCM2, also named CDCL1 and BM28, is a human nuclear protein that plays an important role in 2 crucial steps of the cell cycle, namely, onset of DNA replication and cell division. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0798 Product name: Recombinant human MCM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 657-904 aa of BC007670 Sequence: FDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF Predict reactive species Full Name: minichromosome maintenance complex component 2 Calculated Molecular Weight: 102 kDa Observed Molecular Weight: 116-125 kDa GenBank Accession Number: BC007670 Gene Symbol: MCM2 Gene ID (NCBI): 4171 RRID: AB_3672020 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49736 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.