Iright
BRAND / VENDOR: Proteintech

Proteintech, 84547-2-RR, ZMPSTE24 Recombinant monoclonal antibody

CATALOG NUMBER: 84547-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The ZMPSTE24 (84547-2-RR) by Proteintech is a Recombinant antibody targeting ZMPSTE24 in IF/ICC, ELISA applications with reactivity to human samples 84547-2-RR targets ZMPSTE24 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: PC-3 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information ZMPSTE24(CAAX prenyl protease 1 homolog) gene encodes a zinc metalloproteinase involved in the processing of farnesylated proteins(PubMed: 10373325). The significance of ZMPSTE24 in human disease stems from its role as an enzyme necessary for the correct processing and maturation of lamin A ,an intermediate filament component of the nuclear envelope (PubMed: 16297189). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33613 Product name: Recombinant human ZMPSTE24 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 225-475 aa of BC037283 Sequence: TPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGMEPRNEEEGNSEEIKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTMKQH* Predict reactive species Full Name: zinc metallopeptidase (STE24 homolog, S. cerevisiae) Calculated Molecular Weight: 475 aa, 55 kDa GenBank Accession Number: BC037283 Gene Symbol: ZMPSTE24 Gene ID (NCBI): 10269 RRID: AB_3672054 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O75844 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924