Proteintech, 84553-1-RR, ANP32CP Recombinant monoclonal antibody

Size: 20ul / 100ul The ANP32CP (84553-1-RR) by Proteintech is a Recombinant antibody targeting ANP32CP in WB, IF/ICC, ELISA applications with reactivity to human samples 84553-1-RR targets ANP32CP in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HUVEC cells, BxPC-3 cells, LNCaP cells, MCF-7 cells, DU 145 cells Positive IF/ICC detected in: LNCaP cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information ANP32CP (acidic nuclear phosphoprotein 32 family member C, pseudogene), also known as PP32R1. It is expected to be located in nucleus and perinuclear region of cytoplasm. Expressed in activated stem cells, such as mobilized CD34+ cells and cord blood CD34+ cells, but not in resting bone marrow CD34+ cells. Expressed in a variety of neoplastic cell lines, mainly in prostatic adenocarcinoma cell lines. Not expressed in normal prostatic tissue (PMID: 10086381). The calculated molecular weight of ANP32CP is 27 kDa. The protein could be the product of a pseudogene. Gene encoding ANP32CP is intronless suggesting that is pseudogene generated by retrotransposition. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35293 Product name: Recombinant human ANP32CP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 141-234 aa of NM_012403.1 Sequence: LDSCYWDHKEAPYSDIEDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEGEEEDVSGGDEEDEEGYNDGEVDGEEDEEELGEEERGQKRK Predict reactive species Full Name: acidic (leucine-rich) nuclear phosphoprotein 32 family, member C Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: NM_012403.1 Gene Symbol: ANP32C/PP32R1 Gene ID (NCBI): 23520 RRID: AB_3672061 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O43423 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.