Iright
BRAND / VENDOR: Proteintech

Proteintech, 84555-2-RR, OSMR Recombinant monoclonal antibody

CATALOG NUMBER: 84555-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The OSMR (84555-2-RR) by Proteintech is a Recombinant antibody targeting OSMR in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 84555-2-RR targets OSMR in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, Raji cells, A375 cells, HEK-293 cells, HepG2 cells, SH-SY5Y cells, NIH/3T3 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Oncostatin M (OSM) is a member of interleukin-6 family cytokines that modulates proliferation and differentiation in numerous cells (PMID: 22982441). OSM signals via a receptor complex comprising gp130 and the OSMR (also called OSMRβ) (PMID: 8999038). OSMR is a single-pass membrane protein that belongs to the type I cytokine receptor family. OSMR mRNA is expressed at relatively high levels in all neural cells and fibroblast, epithelial, and various tumor cell lines (PMID: 8999038). It has also been shown that OSMR associates with IL31RA to form the heterodimeric IL31 receptor (PMID: 15184896). OMSR has a calculated molecular weight of 110 kDa, with an apparent molecular weight of 150-180 kDa (PMID: 8999038; 17028186; 39266541; 34644107). A 70 kDa soluble form can be detected by western blot (PMID: 17028186). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1426 Product name: Recombinant human OSMR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-342 aa of BC010943 Sequence: MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILFVFPKDKLVEEGTNVTICYVSRNIQNNVSCYLEGKQIHGEQLDPHVTAFNLNSVPFIRNKGTNIYCEASQGNVSEGMKGIVLFVSKVLEEPKDFSCETEDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQDSQETYNFTLIAENYLRKRSVNILFNLTHRGETRVVTAHRGH Predict reactive species Full Name: oncostatin M receptor Calculated Molecular Weight: 110 kDa Observed Molecular Weight: ~180 kDa GenBank Accession Number: BC010943 Gene Symbol: OSMR Gene ID (NCBI): 9180 RRID: AB_3672064 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q99650 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924