Iright
BRAND / VENDOR: Proteintech

Proteintech, 84558-1-RR, Integrin beta-8 Recombinant monoclonal antibody

CATALOG NUMBER: 84558-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Integrin beta-8 (84558-1-RR) by Proteintech is a Recombinant antibody targeting Integrin beta-8 in WB, ELISA applications with reactivity to human samples 84558-1-RR targets Integrin beta-8 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:9000 Background Information Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin beta-8 (ITGB8), belongs to the integrin beta chain family, contains an N-terminal signal peptide, a large extracellular domain that includes four cysteine-rich repeats, a transmembrane domain, and a C-terminal cytoplasmic domain (PMID: 1918072). Integrin beta-8 associates with integrin alpha-V (ITGAV) to form an αvβ8 heterodimer which has been shown to bind vitronectin, fibronectin, and a latency-associated peptide of TGF-β1/3 (PMID: 27033701). Integrin beta-8 contains multiple potential N-linked glycosylation sites. The observed molecular mass of approximately 95-100 kDa for integrin beta-8 is larger than the predicted 86 kDa, consistent with substantial glycosylation (PMID: 1918072). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag31161 Product name: Recombinant human Integrin beta-8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 460-620 aa of NM_002214 Sequence: KIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECTDPRSI Predict reactive species Full Name: integrin, beta 8 Calculated Molecular Weight: 86 kDa Observed Molecular Weight: 95-100 kDa GenBank Accession Number: NM_002214 Gene Symbol: Integrin beta 8 Gene ID (NCBI): 3696 RRID: AB_3672067 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P26012 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924