Iright
BRAND / VENDOR: Proteintech

Proteintech, 84567-2-RR, DPCR1 Recombinant monoclonal antibody

CATALOG NUMBER: 84567-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The DPCR1 (84567-2-RR) by Proteintech is a Recombinant antibody targeting DPCR1 in WB, ELISA applications with reactivity to human samples 84567-2-RR targets DPCR1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: JAR cells, human heart tissue, SGC-7901 cells, MKN-45 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information Diffuse panbronchiolitis critical region 1 (DPCR1) is located in the major histocompatibility complex (MHC) class I. DPCR1 is downregulated in invasive pituitary adenoma compared with that in non-invasive tumors, but upregulated in the precursor of gastric carcinogenesis (PMID: 29242154). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33318 Product name: Recombinant human DPCR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-448 aa of NM_080870 Sequence: DHIVLHSGQRPPELPKSTEIHEQKRHCNTTRHSKPTDKPTGNSKTIDHKSSTDNHEAPPTSEENSSNQGKDPMIRNQRSVDPADSTTTHKESAGKKHITPAPKSKINCRKSTTGKSTVTRKSDKTGRPLEKSMSTLDKTSTSSHKTTTSFHNSGNSQTKQKSTSFPEKITAASKTTYKTTGTPEESEKTEDSRTTVASDKLLTKTTKNIQETISANELTQSLAEPTEHGGRTANENNTPSPAEPTENRERTANENKKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKGIHAGQMGENDSFPAWA Predict reactive species Full Name: diffuse panbronchiolitis critical region 1 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: NM_080870 Gene Symbol: DPCR1 Gene ID (NCBI): 135656 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q3MIW9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924