Iright
BRAND / VENDOR: Proteintech

Proteintech, 84572-4-RR, CTRL Recombinant monoclonal antibody

CATALOG NUMBER: 84572-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The CTRL (84572-4-RR) by Proteintech is a Recombinant antibody targeting CTRL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 84572-4-RR targets CTRL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse stomach tissue, mouse pancreas tissue, rat pancreas tissue Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CTRL(Chymotrypsin-like protease) is also named as CTRL1 and belongs to the peptidase S1 family. The CTRL1 enzyme is active over a broad pH range. It expresses in pancreas and presence in intestinal fluid after stimulation of pancreatic secretion as a digestive enzyme(PMID:9065485). This gene encode a protein of 264 amino acid and the protein has a signal peptide of 18 amino acid and a propeptide of 15 amino acid. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2214 Product name: Recombinant Human CTRL protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 19-264 aa of BC063475 Sequence: CGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN Predict reactive species Full Name: chymotrypsin-like Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: BC063475 Gene Symbol: CTRL Gene ID (NCBI): 1506 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P40313 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924