Proteintech, 84602-5-RR, CORO1A Recombinant monoclonal antibody

Size: 20ul / 100ul The CORO1A (84602-5-RR) by Proteintech is a Recombinant antibody targeting CORO1A in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 84602-5-RR targets CORO1A in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, RAW 264.7 cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse spleen tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Jurkat cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CORO1A also known as TACO, belongs to the WD repeat coronin family. CORO1A is recruited to phagosomes and actively retained by surviving mycobacteria and is usually released before phagosome fusion with or maturation into lysosomes. CORO1A is expressed in the brain, thymus, spleen, bone marrow, and lymph nodes. Mutations in CORO1A cause Immunodeficiency 8 with lymphoproliferation (IMD8)(PMID: 10338208). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12139 Product name: Recombinant human CORO1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-461 aa of BC110374 Sequence: MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK Predict reactive species Full Name: coronin, actin binding protein, 1A Calculated Molecular Weight: 461 aa, 51 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC110374 Gene Symbol: CORO1A Gene ID (NCBI): 11151 RRID: AB_3672091 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P31146 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.