Iright
BRAND / VENDOR: Proteintech

Proteintech, 84612-3-RR, PDP1 Recombinant monoclonal antibody

CATALOG NUMBER: 84612-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The PDP1 (84612-3-RR) by Proteintech is a Recombinant antibody targeting PDP1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 84612-3-RR targets PDP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MDA-MB-231 cells, PC-3 cells, U-87 MG cells, mouse skeletal muscle tissue, mouse heart tissue Positive IHC detected in: mouse skeletal muscle tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Pyruvate dehydrogenase phosphatase 1 (PDP1), also known as PPM2C, is a key hormone-regulated metabolic enzyme that dephosphorylates and activates pyruvate dehydrogenase (PDH), thereby stimulating the conversion of pyruvate into acetyl-CoA (PMID: 36453802). PDP1 expression is regulated by FLT3-ITD in a context-dependent manner, and that it is centrally involved in the adaptation of AML glucose metabolism to the requirements of proliferation, survival and the therapeutic response to FLT3 inhibition (PMID: 37935978). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15453 Product name: Recombinant human PPM2C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC047619 Sequence: MPAPTQLFFPLIRNCELSRIYGTACYCHHKHLCCSSSYIPQSRLRYTPHPAYATFCRPKENWWQYTQGRRYASTPQKFYLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQA Predict reactive species Full Name: protein phosphatase 2C, magnesium-dependent, catalytic subunit Calculated Molecular Weight: 537 aa, 61 kDa Observed Molecular Weight: 55-61 kDa GenBank Accession Number: BC047619 Gene Symbol: PDP1 Gene ID (NCBI): 54704 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9P0J1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924