Proteintech, 84613-2-RR, BTD Recombinant monoclonal antibody

Size: 20ul / 100ul The BTD (84613-2-RR) by Proteintech is a Recombinant antibody targeting BTD in WB, ELISA applications with reactivity to human, mouse samples 84613-2-RR targets BTD in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information BTD(Biotinidase) functions to recycle protein-bound biotin by cleaving biocytin (biotin-epsilon-lysine), a normal product of carboxylase degradation, resulting in the regeneration of free biotin. BTD has also been shown to have biotinyl transferase activity. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9449 Product name: Recombinant human BTD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 194-543 aa of BC012099 Sequence: FNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERD Predict reactive species Full Name: biotinidase Calculated Molecular Weight: 543 aa, 61 kDa Observed Molecular Weight: 61 kDa GenBank Accession Number: BC012099 Gene Symbol: BTD Gene ID (NCBI): 686 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P43251 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.