Iright
BRAND / VENDOR: Proteintech

Proteintech, 84656-4-RR, RXRB Recombinant monoclonal antibody

CATALOG NUMBER: 84656-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The RXRB (84656-4-RR) by Proteintech is a Recombinant antibody targeting RXRB in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84656-4-RR targets RXRB in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SK-BR-3 cells, K-562 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Retinoid X Receptor beta (RXRB) is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid. RXRB heterodimerizes with other nuclear hormone receptors, such as RAR, the thyroid hormone receptor, and the vitamin D3 receptor, to enhance binding to their cognate response elements. (PMID: 8257090) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0263 Product name: Recombinant human RXRB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-238 aa of BC001167 Sequence: RDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLT Predict reactive species Full Name: retinoid X receptor, beta Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC001167 Gene Symbol: RXRB Gene ID (NCBI): 6257 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P28702 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924