Iright
BRAND / VENDOR: Proteintech

Proteintech, 84663-1-RR, VRK2 Recombinant monoclonal antibody

CATALOG NUMBER: 84663-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The VRK2 (84663-1-RR) by Proteintech is a Recombinant antibody targeting VRK2 in WB, ELISA applications with reactivity to human samples 84663-1-RR targets VRK2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells, HepG2 cells, HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Vaccinia-related kinase 2 (VRK2) is a serine/threonine kinase that plays a significant role in various cellular processes, including cell survival, proliferation, and DNA damage response. The VRK2 gene is known to produce two main splice variants: VRK2A and VRK2B, with VRK2A being the predominant form in humans. VRK2 is involved in several key biological functions. It is known to enhance cell survival by acting as an anti-apoptotic factor, which is particularly crucial in cancer biology. The overexpression of VRK2 has been linked to increased drug sensitivity in cancer cells, suggesting that this kinase may play a role in therapeutic responses. Additionally, high levels of VRK2 protein have been associated with improved survival rates in specific subgroups of astrocytomas, a type of brain tumor. (PMID: 29872222; 37943248; 24079673) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4019 Product name: Recombinant human VRK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-353 aa of BC027854 Sequence: MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDVKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVN Predict reactive species Full Name: vaccinia related kinase 2 Calculated Molecular Weight: 508 aa, 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC027854 Gene Symbol: VRK2 Gene ID (NCBI): 7444 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q86Y07 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924