Proteintech, 84676-3-RR, GANC Recombinant monoclonal antibody

Size: 20ul / 100ul The GANC (84676-3-RR) by Proteintech is a Recombinant antibody targeting GANC in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 84676-3-RR targets GANC in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, mouse cerebellum tissue, rat cerebellum tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information GANC (Glucosidase Alpha, Neutral C) is a Protein Coding gene. Diseases associated with GANC include Pompe Disease and Autosomal Recessive Limb-Girdle Muscular Dystrophy Type 2A. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35067 Product name: Recombinant human GANC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-210 aa of BC059406 Sequence: VTTDEDSTRFQIINEASKVPLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGSLILADGKGDLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEETSVDTSQENQEDLGLWEEKFGKFVDIKANGP Predict reactive species Full Name: glucosidase, alpha; neutral C Calculated Molecular Weight: 104 kDa Observed Molecular Weight: 100-105 kDa GenBank Accession Number: BC059406 Gene Symbol: GANC Gene ID (NCBI): 2595 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8TET4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.