Proteintech, 84705-4-RR, CYP51A1 Recombinant monoclonal antibody

Size: 20ul / 100ul The CYP51A1 (84705-4-RR) by Proteintech is a Recombinant antibody targeting CYP51A1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 84705-4-RR targets CYP51A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HuH-7 cells, HEK-293 cells, RAW 264.7 cells, mouse testis tissue, rat liver tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HuH-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Lanosterol 14-alpha demethylase (cytochrome P450(51), CYP51A1) belongs to the evolutionarily conserved family of cytochrome P450 and catalyzes one of the key steps in cholesterol biosynthesis. CYP51A1 protein is targeted for degradation when exposed to nitric oxide generated under inflammatory conditions by NOS2 or released from NO donor compounds (PMID: 28830911). CYP51A1 is a prognostic marker in certain cancers, including Cervical squamous cell carcinoma, Head and neck squamous cell carcinoma, Kidney chromophobe, and Kidney renal clear cell carcinoma (PMID: 24711211). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4235 Product name: Recombinant human CYP51A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 146-509 aa of BC032322 Sequence: GKGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSIIEKETKEYFESWGESGEKNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLPPLTYDQLKDLNLLDRCIKETLRLRPPVMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK Predict reactive species Full Name: cytochrome P450, family 51, subfamily A, polypeptide 1 Calculated Molecular Weight: 509 aa, 57 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC032322 Gene Symbol: CYP51A1 Gene ID (NCBI): 1595 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q16850 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.