Proteintech, 84708-1-RR, C12orf29 Recombinant monoclonal antibody

Size: 20ul / 100ul The C12orf29 (84708-1-RR) by Proteintech is a Recombinant antibody targeting C12orf29 in WB, ELISA applications with reactivity to human, rat samples 84708-1-RR targets C12orf29 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, U-87 MG cells, LNCaP cells, K-562 cells, rat pancreas tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information C12orf29, also known as RLIG1, is a 37 kDa human protein consisting of 325 amino acids. It catalyzes ATP-dependent RNA ligation via a three-step mechanism involving tandem auto- and RNA AMPylation (PMID: 36792600). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35681 Product name: Recombinant human C12orf29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of NM_001009894.2 Sequence: MKRLGSVQRKMPCVFVTEVKEEPSSKREHQPFKVLATETVSHKALDADIYSAIPTEKVDGTCCYVTTYKDQPYLWARLDRKPNKQAEKRFKNFLHSKENPKEFFWNVEEDFKPAPECWIPAKETEQINGNPVPDENGHIPGWVPVEKNNK Predict reactive species Full Name: chromosome 12 open reading frame 29 Calculated Molecular Weight: 37kDa，325aa Observed Molecular Weight: 37 kDa GenBank Accession Number: NM_001009894.2 Gene Symbol: C12orf29 Gene ID (NCBI): 91298 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N999 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.