Proteintech, 84729-4-RR, MECR Recombinant monoclonal antibody

Size: 20ul / 100ul The MECR (84729-4-RR) by Proteintech is a Recombinant antibody targeting MECR in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 84729-4-RR targets MECR in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, HeLa cells, mouse heart tissue, rat heart tissue, mouse stomach tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells, C2C12 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Mitochondrial 2-enoyl-acyl-carrier protein reductase (MECR) is an enzyme in the mitochondrial fatty acid synthase (mtFAS) pathway. MECR is involved in the synthesis of lipoic acid and is required for mitochondrial respiratory competence. MECR is highly expressed in skeletal and heart muscles and exhibits lower expression in placenta, liver, kidney, and pancreas. It is weakly expressed or not expressed in the lung (PMID: 32440681, PMID: 37734847, PMID: 38296034). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0465 Product name: Recombinant mouse Mecr protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 117-373 aa of BC003864 Sequence: SSVSALKPGDWVIPANAGLGTWRTEAVFSEEALIGIPKDIPLQSAATLGVNPCTAYRMLVDFEQLQPGDSVIQNASNSGVGQAVIQIASALRLKTINVVRDRPDIKKLTDRLKDLGADYVLTEEELRMPETKTIFKDLPLPRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSLLIFKDLKLRGFWLSQWKKNHSPDEFKELILTLCNLIRQGRLTAPSCSEVPLQGYQQALEASMKPFVSSKQILTM Predict reactive species Full Name: mitochondrial trans-2-enoyl-CoA reductase Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 37-40 kDa GenBank Accession Number: BC003864 Gene Symbol: MECR Gene ID (NCBI): 26922 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9DCS3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.