Iright
BRAND / VENDOR: Proteintech

Proteintech, 84732-2-RR, EPB41L4B Recombinant monoclonal antibody

CATALOG NUMBER: 84732-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The EPB41L4B (84732-2-RR) by Proteintech is a Recombinant antibody targeting EPB41L4B in WB, ELISA applications with reactivity to human, mouse samples 84732-2-RR targets EPB41L4B in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, HEK-293T cells, HepG2 cells, HaCaT cells, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The 4.1 proteins, encoded by the EPB41 (erythrocyte protein band 4.1) genes, are components of the cortical cytoskeleton underlying the cell membrane. The family of 4.1 proteins consists of the eponymous 4.1R protein first identified in erythrocytes (gene: EPB41), 4.1N (EPB41L1), 4.1G (EPB41L2), 4.1B (EPB41L3) as well as the less closely related members NBL4 (EPB41L4A), EHM2 (EPB41L4B) and EPB41L5 (EPB41L5). EHM2 is conspicuous in tumor cells with high migratory potential, such as metastatic melanoma and fibrosarcoma cells. In prostate cancer, EHM2 has been reported to be overexpressed and to diminish adhesion of prostate cancer cells to collagen. (PMID: 20860828) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag36353 Product name: Recombinant human EPB41L4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 550-700 aa of NM_00138562 Sequence: TPALFSEAAAHLKKLELETVKAAGPWPPLHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVNIQGGKEESPFVNINKKSSLQDASVRSPIPIRVETAQPAVEKPEIKPPRVRKLTRQYSFDEDDLPPDLAEAVGVTTS Predict reactive species Full Name: erythrocyte membrane protein band 4.1 like 4B Calculated Molecular Weight: 99kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: NM_00138562 Gene Symbol: EPB41L4B Gene ID (NCBI): 54566 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H329 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924