Proteintech, 84737-1-RR, C17orf68 Recombinant monoclonal antibody

Size: 20ul / 100ul The C17orf68 (84737-1-RR) by Proteintech is a Recombinant antibody targeting C17orf68 in WB, ELISA applications with reactivity to human samples 84737-1-RR targets C17orf68 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Conserved telomere maintenance component 1 (CTC1) is a subunit of an alpha accessory factor (AAF) that stimulates the activity of DNA polymerase-alpha-primase, the enzyme that initiates DNA replication (PMID: 19119139). CTC1 also functions in a telomere-associated complex with STN1 and TEN1 (PMID: 19854130). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28167 Product name: Recombinant human C17orf68 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 337-566 aa of BC111783 Sequence: PSNSEDKKDPESLVRYSRLLSYSGAVTGVLNEPAGLYELDGQLGLCLAYQQFRGLRRVMRPGVCLQLQDVHLLQSVGGGTRRPVLAPCLRGAVLLQSFSRQKPGAHSSRQAYGASLYEQLVWERQLGLPLYLWATKALEELACKLCPHVLRHHQFLQHSSPGSPSLGLQLLAPTLDLLAPPGSPVRNAHNEILEEPHHCPLQKYTRLQTPSSFPTLATLKEEGQRKAWAS Predict reactive species Full Name: chromosome 17 open reading frame 68 Calculated Molecular Weight: 1217 aa, 135 kDa Observed Molecular Weight: 140/145 kDa GenBank Accession Number: BC111783 Gene Symbol: CTC1 Gene ID (NCBI): 80169 RRID: AB_3672121 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q2NKJ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.