Product Description
Size: 20ul / 100ul
The EVI5 (84738-2-RR) by Proteintech is a Recombinant antibody targeting EVI5 in IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples
84738-2-RR targets EVI5 in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: U2OS cells
Positive FC (Intra) detected in: U2OS cells
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:200-1:800
Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500
Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
Background Information
EVI5 functions as a regulator of cell cycle progression by stabilizing the FBXO5 protein and promoting cyclin-A accumulation during interphase. It may play a role in cytokinesis (PMID: 16439210).
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag26739 Product name: Recombinant human EVI5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC156793 Sequence: MVTNKMTAAFRNPSGKQVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSTSLHTTSSSTTLSTPALSPSSPSQLSP Predict reactive species
Full Name: ecotropic viral integration site 5
Calculated Molecular Weight: 810 aa, 93 kDa
GenBank Accession Number: BC156793
Gene Symbol: EVI5
Gene ID (NCBI): 7813
RRID: AB_3672122
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purfication
UNIPROT ID: O60447
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924