Proteintech, 84765-4-RR, PDIA2 Recombinant monoclonal antibody

Size: 20ul / 100ul The PDIA2 (84765-4-RR) by Proteintech is a Recombinant antibody targeting PDIA2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 84765-4-RR targets PDIA2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, rat pancreas tissue, mouse stomach tissue, rat stomach tissue Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information PDIA2 (Protein disulfide-isomerase A2), a member of PDI family, is an ER protein chaperone that catalyzes the formation and breakage of disulfide bonds between cysteine residues and can inhibit aggregation of misfolded proteins by catalyzing rearrangement of -S-S- bonds in proteins. (PMID: 23486466) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35301 Product name: Recombinant human PDIA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 231-390 aa of NM_006849.2 Sequence: RADFPVDEELGLDLGDLSRFLVTHSMRLVTEFNSQTSAKIFAARILNHLLLFVNQTLAAHRELLAGFGEAAPRFRGQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRLVNLETTKKYAPVDGGPVTAASITAFCHAVLNGQVKPYLLSQEIPPDWDQRPV Predict reactive species Full Name: protein disulfide isomerase family A, member 2 Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: NM_006849.2 Gene Symbol: PDIA2 Gene ID (NCBI): 64714 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q13087 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.