Iright
BRAND / VENDOR: Proteintech

Proteintech, 84768-2-RR, NSUN5 Recombinant monoclonal antibody

CATALOG NUMBER: 84768-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The NSUN5 (84768-2-RR) by Proteintech is a Recombinant antibody targeting NSUN5 in WB, IF/ICC, ELISA applications with reactivity to human samples 84768-2-RR targets NSUN5 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells Positive IF/ICC detected in: HeLa cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information NSUN5 is a conserved RNA methyltransferase belonging to the Nop2/SUN domain family, which is highly conserved from archaea to eukaryotes and has close contact with RNA methylation because of their S-adenosyl methionine binding-domain. NSUN5 was a promoter in the progression of CRC mainly through cell cycle regulation (PMID: 32774740). Loss of NSUN5 induces growth phenotypes in mice and different mammalian cells, which is likely connected to the requirement of NSUN5 for ribosomal RNA modification and normal global protein translation, especially in highly proliferative cells (PMID: 31722427). Western blot analysis detected NSUN5 at an apparent molecular mass of 47 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7711 Product name: Recombinant human NSUN5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 117-466 aa of BC008084 Sequence: RNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVEVPSSASQAKASAPERTPSPAPKRKKRQQRAAAGACTPPCT Predict reactive species Full Name: NOL1/NOP2/Sun domain family, member 5 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 47~51 kDa GenBank Accession Number: BC008084 Gene Symbol: NSUN5 Gene ID (NCBI): 55695 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96P11 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924