Iright
BRAND / VENDOR: Proteintech

Proteintech, 84777-3-RR, HNMT Recombinant monoclonal antibody

CATALOG NUMBER: 84777-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The HNMT (84777-3-RR) by Proteintech is a Recombinant antibody targeting HNMT in WB, ELISA applications with reactivity to human samples 84777-3-RR targets HNMT in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information HNMT, a histamine-metabolizing enzyme, inactivates histamine by N-methylation. It plays an important role in degrading histamine and in regulating the airway response to histamine. HNMT in human astrocytes play a role in the regulation of extraneuronal histamine concentration and the activities of histaminergic neurons. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2462 Product name: Recombinant human HNMT protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-292 aa of BC020677 Sequence: MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGDENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA Predict reactive species Full Name: histamine N-methyltransferase Calculated Molecular Weight: 292 aa, 33 kDa Observed Molecular Weight: 30-33 kDa GenBank Accession Number: BC020677 Gene Symbol: HNMT Gene ID (NCBI): 3176 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P50135 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924