Iright
BRAND / VENDOR: Proteintech

Proteintech, 84809-4-RR, SPAG5 Recombinant monoclonal antibody

CATALOG NUMBER: 84809-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The SPAG5 (84809-4-RR) by Proteintech is a Recombinant antibody targeting SPAG5 in WB, ELISA applications with reactivity to human samples 84809-4-RR targets SPAG5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, PC-3 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SPAG5, also named as MAP126, Astrin and Deepest, is necessary for normal spindle formation during mitosis. It is highly expressed in testis. SPAG5 has different localization in somatic versus male germ cells suggesting the possibility of different function. This antibody is specific to SPAG5. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6485 Product name: Recombinant human SPAG5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 844-1193 aa of BC000322 Sequence: TVENLTAKLASTIADNQEQDLEKTRQYSQKLGLLTEQLQSLTLFLQTKLKEKTEQETLLLSTACPPTQEHPLPNDRTFLGSILTAVADEEPESTPVPLLGSDKSAFTRVASMVSLQPAETPGMEESLAEMSIMTTELQSLCSLLQESKEEAIRTLQRKICELQARLQAQEEQHQEVQKAKEADIEKLNQALCLRYKNEKELQEVIQQQNEKILEQIDKSGELISLREEVTHLTRSLRRAETETKVLQEALAGQLDSNCQPMATNWIQEKVWLSQEVDKLRVMFLEMKNEKEKLMIKFQSHRNILEENLRRSDKELEKLDDIVQHIYKTLLSIPEVVRGCKELQGLLEFLS Predict reactive species Full Name: sperm associated antigen 5 Calculated Molecular Weight: 134 kDa Observed Molecular Weight: 135 kDa, 150 kDa GenBank Accession Number: BC000322 Gene Symbol: SPAG5 Gene ID (NCBI): 10615 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q96R06 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924