Proteintech, 84816-4-RR, FceR1a Recombinant monoclonal antibody

Size: 20ul / 100ul The FceR1a (84816-4-RR) by Proteintech is a Recombinant antibody targeting FceR1a in WB, ELISA applications with reactivity to mouse samples 84816-4-RR targets FceR1a in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: MC/9 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Fc epsilon Receptor I alpha (FceR1a) is a single-pass type I membrane protein that contains 2 immunoglobulin-like domains. FceR1a forms a tetrameric complex with one beta and two gamma subunits (PMID: 19406478). FceRI is the high-affinity receptor for the Fc region of immunoglobulin E (IgE) (PMID: 1532373). It is expressed on mast cells and basophils and plays a central role in the allergic response (PMID: 2148316). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1740 Product name: Recombinant Mouse Fc-epsilon RI-alpha (FcERI) protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-204 aa of NM_010184.2 Sequence: ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQ Predict reactive species Full Name: Fc receptor, IgE, high affinity I, alpha polypeptide Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: NM_010184.2 Gene Symbol: FceR1a Gene ID (NCBI): 14125 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P20489 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.