Iright
BRAND / VENDOR: Proteintech

Proteintech, 84821-3-RR, CYP24A1 Recombinant monoclonal antibody

CATALOG NUMBER: 84821-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The CYP24A1 (84821-3-RR) by Proteintech is a Recombinant antibody targeting CYP24A1 in WB, ELISA applications with reactivity to human, mouse, rat samples 84821-3-RR targets CYP24A1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat thymus tissue, A549 cells, HeLa cells, A431 cells, rat lung tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CYP24A1(1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial) catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D3) and 1-alpha,25-dihydroxyvitamin D3. Cholecalciferol is metabolized by the 25-hydroxylases (CYP2R1 and CYP27A1) in the liver before 25-hydroxycholecalciferol (25(OH)D3) relocates to the circulation (PMID:20362668). The gene CYP24A1 has three isoforms, for the transit peptide "mitochondrial domain" removed, the MW of CYP24A1 will be 55-59 kDa, 47-51 kDa, and 43 kDa. This antibody is specific to CYP24A1. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17089 Product name: Recombinant human CYP24A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC109083 Sequence: MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQ Predict reactive species Full Name: cytochrome P450, family 24, subfamily A, polypeptide 1 Calculated Molecular Weight: 514 aa, 59 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC109083 Gene Symbol: CYP24A1 Gene ID (NCBI): 1591 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q07973 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924