Product Description
Size: 20ul / 100ul
The EZH2 (84824-2-RR) by Proteintech is a Recombinant antibody targeting EZH2 in WB, IHC, IF/ICC, ELISA, ChIP-qPCR applications with reactivity to human, mouse, rat samples
84824-2-RR targets EZH2 in WB, IHC, IF/ICC, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: Jurkat cells, Raji cells, NIH/3T3 cells, C6 cells
Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HepG2 cells
Positive ChIP-qPCR detected in: NCCIT cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:8000
Immunohistochemistry (IHC): IHC : 1:250-1:1000
Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000
CHIP-QPCR: CHIP-QPCR : 1:10-1:100
Background Information
EZH2 (enhancer of zeste homologue 2, also known as KMT6) is a member of Polycomb group (PcG) family and encodes a histone methyl transferase that has an essential role in promoting histone H3 lysine 27 trimethylation (H3K27me3) and epigenetic gene silencing. EZH2 is important for cell proliferation and inhibition of cell differentiation, and is implicated in cancer progression. Overexpression of EZH2 is a marker of advanced and metastatic disease in many solid tumors, including prostate and breast cancer. This antibody detected EZH2 protein as a single band with a molecular weight (MW) of 91-100 kDa in multiple cell lines. The phosphorylation may result in the higher molecular weight (calculated MW as 80-86 kDa). (20935635, 21367748)
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag16789 Product name: Recombinant human EZH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 158-261 aa of BC010858 Sequence: HGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECT Predict reactive species
Full Name: enhancer of zeste homolog 2 (Drosophila)
Calculated Molecular Weight: 751 aa, 86 kDa
Observed Molecular Weight: 90-102 kDa
GenBank Accession Number: BC010858
Gene Symbol: EZH2
Gene ID (NCBI): 2146
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q15910
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924