Iright
BRAND / VENDOR: Proteintech

Proteintech, 84849-4-RR, NUAK2 Recombinant monoclonal antibody

CATALOG NUMBER: 84849-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The NUAK2 (84849-4-RR) by Proteintech is a Recombinant antibody targeting NUAK2 in WB, ELISA applications with reactivity to human samples 84849-4-RR targets NUAK2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, SGC-7901 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information NUAK2, also known as OMPHK2 and SNARK, is the fourth member of the AMPK kinase family. The molecular mass of NUAK2 is 69 kDa and it plays a key role in neural tube closure during embryonic development (PMID: 32845958). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35302 Product name: Recombinant human NUAK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10005287 of NM_030952 Sequence: DPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT Predict reactive species Full Name: NUAK family, SNF1-like kinase, 2 Calculated Molecular Weight: 70kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: NM_030952 Gene Symbol: NUAK2 Gene ID (NCBI): 81788 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9H093 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924