Iright
BRAND / VENDOR: Proteintech

Proteintech, 84859-3-RR, YARS Recombinant monoclonal antibody

CATALOG NUMBER: 84859-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The YARS (84859-3-RR) by Proteintech is a Recombinant antibody targeting YARS in WB, IHC, IF/ICC, ELISA applications with reactivity to human, pig samples 84859-3-RR targets YARS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: A431 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Tyrosyl-tRNA synthetase (YARS) is responsible for tyrosyl-tRNA aminoacylation. The functional enzyme exists as a homodimer, has potent leukocyte and monocyte chemotaxis activity, and stimulates production of myeloperoxidase, tumor necrosis factor-α, and tissue factor. A shift in the monomer:dimer equilibrium could result in dysregulation of the cytokines function. (PMID: 33490854) Specification Tested Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35148 Product name: Recombinant human YARS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 400-528 aa of BC016689 Sequence: RTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS Predict reactive species Full Name: tyrosyl-tRNA synthetase Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC016689 Gene Symbol: YARS Gene ID (NCBI): 8565 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P54577 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924