Proteintech, 84918-5-RR, HECTD1 Recombinant monoclonal antibody

Size: 20ul / 100ul The HECTD1 (84918-5-RR) by Proteintech is a Recombinant antibody targeting HECTD1 in WB, ELISA applications with reactivity to human samples 84918-5-RR targets HECTD1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information HECTD1 (E3 ubiquitin-protein ligase), which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates,may be required for development of the head mesenchyme and neural tube closure.It is also involved in sporadic Parkinson's disease(PMID:16714300).This antibody is specific to HECTD1. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14581 Product name: Recombinant human HECTD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-121 aa of BC006237 Sequence: PGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCVHYLKLPEYSSEEIMRERLLAATMEKGFHLN Predict reactive species Full Name: HECT domain containing 1 Calculated Molecular Weight: 2612 aa, 290 kDa Observed Molecular Weight: 290 kDa GenBank Accession Number: BC006237 Gene Symbol: HECTD1 Gene ID (NCBI): 25831 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9ULT8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.