Iright
BRAND / VENDOR: Proteintech

Proteintech, 84920-4-RR, RAD21 Recombinant monoclonal antibody

CATALOG NUMBER: 84920-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The RAD21 (84920-4-RR) by Proteintech is a Recombinant antibody targeting RAD21 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 84920-4-RR targets RAD21 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information RAD21, also named as Nuclear matrix protein 1, is a 631 amino acid protein, which belongs to the rad21 family. The calculated molecular weight of RAD21 is 72 kDa, but the phosphorylated RAD21 is about 120 kDa. The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad21, a gene involved in the repair of DNA double-strand breaks, as well as in chromatid cohesion during mitosis. This protein is a nuclear phospho-protein, which becomes hyperphosphorylated in cell cycle M phase. The highly regulated association of this protein with mitotic chromatin specifically at the centromere region suggests its role in sister chromatid cohesion in mitotic cells. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25481 Product name: Recombinant human RAD21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 147-349 aa of BC050381 Sequence: EEVGNISILQENDFGDFGMDDREIMREGSAFEDDDMLVSTTTSNLLLESEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGGIFDDPPALSEAGVMLPEQPAHDDMDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVT Predict reactive species Full Name: RAD21 homolog (S. pombe) Calculated Molecular Weight: 631 aa, 72 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC050381 Gene Symbol: RAD21 Gene ID (NCBI): 5885 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O60216 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924