Iright
BRAND / VENDOR: Proteintech

Proteintech, 84929-6-RR, TYRO3 Recombinant monoclonal antibody

CATALOG NUMBER: 84929-6-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The TYRO3 (84929-6-RR) by Proteintech is a Recombinant antibody targeting TYRO3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 84929-6-RR targets TYRO3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:125-1:500 Background Information TYRO3 has a structure includes a cytoplasmic domain and an extracellular ligand binding region. And ligand binding at the cell surface induces dimerization and autophosphorylation of TYRO3 on its intracellular domain that provides docking sites for downstream signaling molecules. TYRO3 is associated with many physiological processes including cell survival, migration and differentiation. It has been reported that TYRO3 can be expressed in various regions of the mammalian central nervous system. The molecular mass of TYRO3 is 130 kDa, the apparent molecular mass is higher due to glycosylation.((PMID: 8873131, 23354874, 21539887) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29527 Product name: Recombinant human TYRO3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 451-596 aa of BC049368 Sequence: LRKRRKETRFGQAFDSVMARGEPAVHFRAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQLKQEDSSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRL Predict reactive species Full Name: TYRO3 protein tyrosine kinase Calculated Molecular Weight: 97 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC049368 Gene Symbol: TYRO3 Gene ID (NCBI): 7301 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q06418 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924