Proteintech, 84930-3-RR, BCL11A Recombinant monoclonal antibody

Size: 20ul / 100ul The BCL11A (84930-3-RR) by Proteintech is a Recombinant antibody targeting BCL11A in WB, IF/ICC, ELISA applications with reactivity to human samples 84930-3-RR targets BCL11A in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, Daudi cells, Raji cells, MOLT-4 cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2187 Product name: Recombinant human BCL11A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC021098 Sequence: MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQCNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPRVGIPSGLGAECPSQPPLHGIHIADNNPFNLLRIPGSVSREASGLAEGRFPPTPPLFSPPPRHHLDPHRIERLGAEEMALATHHPSAFDRVLRLNPMAMEPPAMDFSRRLRELAGNTSSPPLSPGRPSPMQRLLQPFQPGSK Predict reactive species Full Name: B-cell CLL/lymphoma 11A (zinc finger protein) Calculated Molecular Weight: 835 aa, 91 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: BC021098 Gene Symbol: BCL11A Gene ID (NCBI): 53335 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H165 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.