Proteintech, 84933-5-RR, YOD1 Recombinant monoclonal antibody

Size: 20ul / 100ul The YOD1 (84933-5-RR) by Proteintech is a Recombinant antibody targeting YOD1 in WB, IF/ICC, ELISA applications with reactivity to human samples 84933-5-RR targets YOD1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, Jurkat cells, HEK-293 cells, HeLa cells Positive IF/ICC detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information YOD1, also known as YOD1 deubiquitinase, belongs to the ovarian tumor (OTU) domain-containing family of deubiquitinating enzymes (DUBs), which play a crucial role in regulating cellular processes by removing ubiquitin molecules from target proteins. YOD1 is particularly involved in the endoplasmic reticulum-associated degradation (ERAD) pathway, where it assists in the clearance of misfolded proteins from the endoplasmic reticulum (ER) by modulating the ubiquitination status of ERAD components. (PMID: 40132762,19818707) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21844 Product name: Recombinant human YOD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 63-348 aa of BC137167 Sequence: LSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV Predict reactive species Full Name: YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae) Calculated Molecular Weight: 348 aa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC137167 Gene Symbol: YOD1 Gene ID (NCBI): 55432 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q5VVQ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.