Iright
BRAND / VENDOR: Proteintech

Proteintech, 84935-6-RR, ATG12 Recombinant monoclonal antibody

CATALOG NUMBER: 84935-6-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The ATG12 (84935-6-RR) by Proteintech is a Recombinant antibody targeting ATG12 in WB, IHC, ELISA applications with reactivity to human samples 84935-6-RR targets ATG12 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, PC-3 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information ATG12, also named as APG12 and APG12L, belongs to the ATG12 family. It is required for autophagy. Free ATG12 is 15kd or 8kd. Conjugated to ATG5, ATG12-ATG5 show 48-55kd. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1791 Product name: Recombinant human ATG12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-187 aa of BC012266 Sequence: MTSREHQVSLCNCVPLLRRLLCDAPWRKARPLHALSRYFRSRVSPSKMAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG Predict reactive species Full Name: ATG12 autophagy related 12 homolog (S. cerevisiae) Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC012266 Gene Symbol: ATG12 Gene ID (NCBI): 9140 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O94817 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924