Proteintech, 84950-3-RR, LARP7 Recombinant monoclonal antibody

Size: 20ul / 100ul The LARP7 (84950-3-RR) by Proteintech is a Recombinant antibody targeting LARP7 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 84950-3-RR targets LARP7 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, HEK-293 cells, HeLa cells, Jurkat cells, K-562 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information LARP7 belongs to the LARP RNA-binding protein family, which includes the lupus LA antigen gene, and modulates the metabolism and function of a variety of RNA species [PMID:20138158]. LARP7 binds to the 7SK RNP complex, and sequesters the positive transcription elongation factor b (P-TEFb) in an inactive form, preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.[PMID:19416841]. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10850 Product name: Recombinant human LARP7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 83-331 aa of BC006981 Sequence: LTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSWIERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIPALRVVEEKKKKKKKKGRMKKEDNIQAKEENMDTSNTSISKMKRSRPTSEGSDIESTEPQKQCSKKKKKRDRVEASSLPEVRTGKRKRSSSEDAESLAPRSKVKKIIQKDIIKEASEASKE Predict reactive species Full Name: La ribonucleoprotein domain family, member 7 Calculated Molecular Weight: 582 aa, 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC006981 Gene Symbol: LARP7 Gene ID (NCBI): 51574 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q4G0J3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.