Product Description
Size: 20ul / 100ul
The GS28 (84971-3-RR) by Proteintech is a Recombinant antibody targeting GS28 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
84971-3-RR targets GS28 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HepG2 cells, SK-BR-3 cells, NIH/3T3 cells, C6 cells, PC-12 cells
Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: NIH/3T3 cells, HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunohistochemistry (IHC): IHC : 1:500-1:2000
Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000
Background Information
GS28, also known as GOSR1, is a 28-kDa Golgi SNARE protein that participates in ER-Golgi and intra-Golgi transport. GS28 is considered to be a core component of the Golgi SNARE complex. (PMID: 8638159)
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag9021 Product name: Recombinant human GS28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-117 aa of BC012620 Sequence: MAAGTSSYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSSTRDGRRDRYSSDTTPLLNGSSQDRMFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQV Predict reactive species
Full Name: golgi SNAP receptor complex member 1
Calculated Molecular Weight: 28.6 kDa
Observed Molecular Weight: 28 kDa
GenBank Accession Number: BC012620
Gene Symbol: GS28
Gene ID (NCBI): 9527
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: O95249
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924