Iright
BRAND / VENDOR: Proteintech

Proteintech, 85004-1-RR, NCOA5 Recombinant monoclonal antibody

CATALOG NUMBER: 85004-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The NCOA5 (85004-1-RR) by Proteintech is a Recombinant antibody targeting NCOA5 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 85004-1-RR targets NCOA5 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: A431 cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Nuclear receptor coactivator 5 (NCOA5), also known as a coactivator independent of AF-2 (CIA), possesses both repressor and activator functions (PMID: 11113208). It can interact with Estrogen Receptor (ER) alpha and ER beta in a ligand-dependent manner. NCOA5 has been shown to regulate the ER alpha-mediated transcription and the c-Myc gene expression (PMID: 11113208; 15073177). Recently identified as a conserved component of pluripotent stem cells, mammalian NCOA5 may contribute to maintaining the pluripotent stem cell population (PMID: 24268775). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14418 Product name: Recombinant human NCOA5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 112-384 aa of BC056872 Sequence: DMRDSRDPMYRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPG Predict reactive species Full Name: nuclear receptor coactivator 5 Calculated Molecular Weight: 579 aa, 66 kDa GenBank Accession Number: BC056872 Gene Symbol: NCOA5 Gene ID (NCBI): 57727 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9HCD5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924