Iright
BRAND / VENDOR: Proteintech

Proteintech, 85010-1-RR, LAIR1 Recombinant monoclonal antibody

CATALOG NUMBER: 85010-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The LAIR1 (85010-1-RR) by Proteintech is a Recombinant antibody targeting LAIR1 in WB, IHC, IF/ICC, ELISA applications with reactivity to mouse samples 85010-1-RR targets LAIR1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1) is a transmembrane glycoprotein with a single immunoglobulin-like domain and a cytoplasmic tail containing two immune receptor tyrosine-based inhibitory motifs (PMID: 9285412). LAIR1 is expressed on the majority of human PBMCs, including NK, T, B, monocytes, and dendritic cells, as well as the majority of thymocytes (PMID: 10229813). It functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of NK cells, B cells and T cells. LAIR1 is a collagen receptor (PMID: 16754721). Tumor-expressed collagens can modulate immune cell function through the inhibitory collagen receptor LAIR1 (PMID: 21955987). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1879 Product name: Recombinant Mouse LAIR1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 22-141 aa of NM_001113474.1 Sequence: QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTY Predict reactive species Full Name: leukocyte-associated Ig-like receptor 1 Calculated Molecular Weight: 30kDa Observed Molecular Weight: 35 kDa, 45 kDa GenBank Accession Number: NM_001113474.1 Gene Symbol: Lair1 Gene ID (NCBI): 52855 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8BG84-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924